![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.265: Pseudouridine synthase [100877] (1 superfamily) consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold |
![]() | Superfamily d.265.1: Pseudouridine synthase [55120] (5 families) ![]() the active site is the most conserved structural region of the superfamily and is located between the subdomains |
![]() | Family d.265.1.2: Pseudouridine synthase II TruB [69746] (2 proteins) contains C-terminal PUA domain |
![]() | Protein Pseudouridine synthase II TruB [69747] (5 species) |
![]() | Species Methanococcus jannaschii [TaxId:2190] [143435] (1 PDB entry) Uniprot Q57612 17-246 |
![]() | Domain d2apoa2: 2apo A:17-246 [127134] Other proteins in same PDB: d2apoa1, d2apob_ protein/RNA complex; complexed with k, zn |
PDB Entry: 2apo (more details), 1.95 Å
SCOPe Domain Sequences for d2apoa2:
Sequence, based on SEQRES records: (download)
>d2apoa2 d.265.1.2 (A:17-246) Pseudouridine synthase II TruB {Methanococcus jannaschii [TaxId: 2190]} elivkeevetnwdygcnpyerkiedlikygvvvvdkprgptshevstwvkkilnldkagh ggtldpkvtgvlpvaleratktipmwhippkeyvclmhlhrdaseedilrvfkeftgriy qrpplkaavkrrlrirkihelelldkdgkdvlfrvkcqsgtyirklcedigealgtsahm qelrrtksgcfeekdavylqdlldayvfwkedgdeeelrrvikpmeyglr
>d2apoa2 d.265.1.2 (A:17-246) Pseudouridine synthase II TruB {Methanococcus jannaschii [TaxId: 2190]} elivkeevetnwdygcnpyerkiedlikygvvvvdkprgptshevstwvkkilnldkagh ggtldpkvtgvlpvaleratktipmwhippkeyvclmhlhrdaseedilrvfkeftgriy qrrirkihelelldkdgkdvlfrvkcqsgtyirklcedigealgtsahmqelrrtksgcf eekdavylqdlldayvfwkedgdeeelrrvikpmeyglr
Timeline for d2apoa2: