SCOPe 2.07: Domain d2apoa2: 2apo A:17-246

Lineage for d2apoa2 (2apo A:17-246)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
   consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold

4. Superfamily d.265.1: Pseudouridine synthase [55120] (5 families)
   the active site is the most conserved structural region of the superfamily and is located between the subdomains

5. Family d.265.1.2: Pseudouridine synthase II TruB [69746] (2 proteins)
   contains C-terminal PUA domain

6. Protein Pseudouridine synthase II TruB [69747] (5 species)

7. Species Methanococcus jannaschii [TaxId:2190] [143435] (1 PDB entry)
   Uniprot Q57612 17-246

8. Domain d2apoa2: 2apo A:17-246 [127134]
   Other proteins in same PDB: d2apoa1, d2apob_
   protein/RNA complex; complexed with k, zn

Details for d2apoa2

PDB Entry: 2apo, 1.95 Å

PDB Description: Crystal Structure of the Methanococcus jannaschii Cbf5 Nop10 Complex

PDB Compounds: (A:) Probable tRNA pseudouridine synthase B

SCOPe Domain Sequences for d2apoa2:

Sequence, based on SEQRES records:

>d2apoa2 d.265.1.2 (A:17-246) Pseudouridine synthase II TruB {Methanococcus jannaschii [TaxId: 2190]}
elivkeevetnwdygcnpyerkiedlikygvvvvdkprgptshevstwvkkilnldkagh
ggtldpkvtgvlpvaleratktipmwhippkeyvclmhlhrdaseedilrvfkeftgriy
qrpplkaavkrrlrirkihelelldkdgkdvlfrvkcqsgtyirklcedigealgtsahm
qelrrtksgcfeekdavylqdlldayvfwkedgdeeelrrvikpmeyglr

Sequence, based on observed residues (ATOM records):

>d2apoa2 d.265.1.2 (A:17-246) Pseudouridine synthase II TruB {Methanococcus jannaschii [TaxId: 2190]}
elivkeevetnwdygcnpyerkiedlikygvvvvdkprgptshevstwvkkilnldkagh
ggtldpkvtgvlpvaleratktipmwhippkeyvclmhlhrdaseedilrvfkeftgriy
qrrirkihelelldkdgkdvlfrvkcqsgtyirklcedigealgtsahmqelrrtksgcf
eekdavylqdlldayvfwkedgdeeelrrvikpmeyglr

Timeline for d2apoa2:

• d2apoa2 first appeared in SCOP 1.73
  
• d2apoa2 appears in SCOPe 2.06
  
• d2apoa2 appears in the current release, SCOPe 2.08