SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2al4e_ (2al4 E:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2144526Protein Glutamate receptor ligand binding core [53881] (5 species)
  7. 2144535Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (134 PDB entries)
  8. 2144599Domain d2al4e_: 2al4 E: [126962]
    automated match to d1lb8a_
    complexed with cx6, qus, zn

Details for d2al4e_

PDB Entry: 2al4 (more details), 1.7 Å

PDB Description: crystal structure of the glur2 ligand binding core (s1s2j) in complex with quisqualate and cx614.
PDB Compounds: (E:) Glutamate receptor 2

SCOPe Domain Sequences for d2al4e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2al4e_ c.94.1.1 (E:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkln
eqglldklknkwwydkgec

SCOPe Domain Coordinates for d2al4e_:

Click to download the PDB-style file with coordinates for d2al4e_.
(The format of our PDB-style files is described here.)

Timeline for d2al4e_: