![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
![]() | Protein Glutamate receptor ligand binding core [53881] (5 species) |
![]() | Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (158 PDB entries) |
![]() | Domain d2al4d_: 2al4 D: [126961] automated match to d1lb8a_ complexed with cx6, qus, zn |
PDB Entry: 2al4 (more details), 1.7 Å
SCOPe Domain Sequences for d2al4d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2al4d_ c.94.1.1 (D:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]} ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne qglldklknkwwydkgec
Timeline for d2al4d_: