SCOPe 2.08: Domain d2al4a_: 2al4 A:

Lineage for d2al4a_ (2al4 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (158 PDB entries)

8. Domain d2al4a_: 2al4 A: [126958]
   automated match to d1lb8a_
   complexed with cx6, qus, zn

Details for d2al4a_

PDB Entry: 2al4, 1.7 Å

PDB Description: crystal structure of the glur2 ligand binding core (s1s2j) in complex with quisqualate and cx614.

PDB Compounds: (A:) Glutamate receptor 2

SCOPe Domain Sequences for d2al4a_:

Sequence; same for both SEQRES and ATOM records:

>d2al4a_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwydkgec

Timeline for d2al4a_:

• d2al4a_ first appeared in SCOP 1.73, called d2al4a1
  
• d2al4a_ appears in SCOPe 2.07