PDB entry 2al4

View 2al4 on RCSB PDB site
Description: CRYSTAL STRUCTURE OF THE GLUR2 LIGAND BINDING CORE (S1S2J) IN COMPLEX WITH quisqualate and CX614.
Class: membrane protein
Keywords: IONOTROPIC GLUTAMATE RECEPTOR, GLUR2, LIGAND BINDING CORE, S1S2, quisqualate, CX614, modulator, MEMBRANE PROTEIN
Deposited on 2005-08-04, released 2005-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19491 (Start-116)
      • see remark 999 (117-118)
    • Uniprot P19491 (119-End)
    Domains in SCOPe 2.07: d2al4a_
  • Chain 'B':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19491 (2-116)
      • see remark 999 (117-118)
    • Uniprot P19491 (119-End)
    Domains in SCOPe 2.07: d2al4b_
  • Chain 'C':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19491 (Start-116)
      • see remark 999 (117-118)
    • Uniprot P19491 (119-End)
    Domains in SCOPe 2.07: d2al4c_
  • Chain 'D':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19491 (Start-116)
      • see remark 999 (117-118)
    • Uniprot P19491 (119-End)
    Domains in SCOPe 2.07: d2al4d_
  • Chain 'E':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19491 (2-116)
      • see remark 999 (117-118)
    • Uniprot P19491 (119-End)
    Domains in SCOPe 2.07: d2al4e_
  • Chain 'F':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19491 (Start-116)
      • see remark 999 (117-118)
    • Uniprot P19491 (119-End)
    Domains in SCOPe 2.07: d2al4f_
  • Heterogens: ZN, QUS, CX6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2al4A (A:)
    ganktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
    ygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtp
    iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
    vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlk
    lneqglldklknkwwydkgecgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2al4A (A:)
    ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
    rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
    aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
    skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
    qglldklknkwwydkgec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2al4B (B:)
    ganktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
    ygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtp
    iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
    vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlk
    lneqglldklknkwwydkgecgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2al4B (B:)
    nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
    ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
    saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
    kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkln
    eqglldklknkwwydkgec
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2al4C (C:)
    ganktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
    ygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtp
    iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
    vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlk
    lneqglldklknkwwydkgecgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2al4C (C:)
    ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
    rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
    aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
    skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
    qglldklknkwwydkgec
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2al4D (D:)
    ganktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
    ygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtp
    iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
    vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlk
    lneqglldklknkwwydkgecgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2al4D (D:)
    ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
    rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
    aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
    skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
    qglldklknkwwydkgec
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2al4E (E:)
    ganktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
    ygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtp
    iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
    vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlk
    lneqglldklknkwwydkgecgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2al4E (E:)
    nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
    ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
    saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
    kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkln
    eqglldklknkwwydkgec
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2al4F (F:)
    ganktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
    ygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtp
    iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
    vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlk
    lneqglldklknkwwydkgecgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2al4F (F:)
    ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
    rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
    aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
    skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
    qglldklknkwwydkgec