SCOPe 2.08: Domain d2akwb6: 2akw B:475-681

Lineage for d2akwb6 (2akw B:475-681)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)

6. Protein Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain [55703] (1 species)
   this domain is non-catalytic

7. Species Thermus thermophilus [TaxId:274] [55704] (12 PDB entries)
   identical sequence to Thermus aquaticus, TaxId: 271

8. Domain d2akwb6: 2akw B:475-681 [126943]
   Other proteins in same PDB: d2akwa_, d2akwb1, d2akwb2, d2akwb3, d2akwb4, d2akwb5
   automated match to d1jjcb5
   protein/RNA complex; complexed with 200, mn, so4

Details for d2akwb6

PDB Entry: 2akw, 2.8 Å

PDB Description: Crystal Structure of T.Thermophilus Phenylalanyl-tRNA synthetase complexed with p-Cl-Phenylalanine

PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOPe Domain Sequences for d2akwb6:

Sequence; same for both SEQRES and ATOM records:

>d2akwb6 d.104.1.1 (B:475-681) Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain {Thermus thermophilus [TaxId: 274]}
alpaffpapdnrgveapyrkeqrlrevlsglgfqevytysfmdpedarrfrldpprllll
nplapekaalrthlfpglvrvlkenldldrperallfevgrvfrereethlagllfgegv
glpwakerlsgyfllkgylealfarlglafrveaqafpflhpgvsgrvlvegeevgflga
lhpeiaqelelppvhlfelrlplpdkp

Timeline for d2akwb6:

• d2akwb6 first appeared in SCOP 1.73
  
• d2akwb6 appears in SCOPe 2.07