Lineage for d2akwb2 (2akw B:400-474)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein)
    duplication: contains two such domains related by pseudo dyad
  6. Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species)
  7. Species Thermus thermophilus [TaxId:274] [46958] (12 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. Domain d2akwb2: 2akw B:400-474 [126939]
    Other proteins in same PDB: d2akwa_, d2akwb3, d2akwb4, d2akwb5, d2akwb6
    automated match to d1jjcb2
    protein/RNA complex; complexed with 200, mn, so4

Details for d2akwb2

PDB Entry: 2akw (more details), 2.8 Å

PDB Description: Crystal Structure of T.Thermophilus Phenylalanyl-tRNA synthetase complexed with p-Cl-Phenylalanine
PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOPe Domain Sequences for d2akwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2akwb2 a.6.1.1 (B:400-474) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
ppeaipfrpeyanrllgtsypeaeqiailkrlgcrvegegptyrvtppshrldlrleedl
veevariqgyetipl

SCOPe Domain Coordinates for d2akwb2 are not available.

Timeline for d2akwb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2akwb1, d2akwb3, d2akwb4, d2akwb5, d2akwb6
View in 3D
Domains from other chains:
(mouse over for more information)
d2akwa_