SCOPe 2.08: Domain d2akwb3: 2akw B:39-151

Lineage for d2akwb3 (2akw B:39-151)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.4: Myf domain [50277] (7 proteins)

6. Protein Domain B2 of PheRS-beta, PheT [50278] (1 species)

7. Species Thermus thermophilus [TaxId:274] [50279] (12 PDB entries)
   identical sequence to Thermus aquaticus, TaxId: 271

8. Domain d2akwb3: 2akw B:39-151 [126940]
   Other proteins in same PDB: d2akwa_, d2akwb1, d2akwb2, d2akwb4, d2akwb5, d2akwb6
   automated match to d1jjcb3
   protein/RNA complex; complexed with 200, mn, so4

Details for d2akwb3

PDB Entry: 2akw, 2.8 Å

PDB Description: Crystal Structure of T.Thermophilus Phenylalanyl-tRNA synthetase complexed with p-Cl-Phenylalanine

PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOPe Domain Sequences for d2akwb3:

Sequence; same for both SEQRES and ATOM records:

>d2akwb3 b.40.4.4 (B:39-151) Domain B2 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
fpiprgvvfarvleahpipgtrlkrlvldagrtvevvsgaenarkgigvalalpgtelpg
lgqkvgerviqgvrsfgmalsprelgvgeygggllefpedalppgtplseawp

Timeline for d2akwb3:

• d2akwb3 first appeared in SCOP 1.73
  
• d2akwb3 appears in SCOPe 2.07