![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) ![]() |
![]() | Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) |
![]() | Protein Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain [55703] (1 species) this domain is non-catalytic |
![]() | Species Thermus thermophilus [TaxId:274] [55704] (12 PDB entries) identical sequence to Thermus aquaticus, TaxId: 271 |
![]() | Domain d2akwb6: 2akw B:475-681 [126943] Other proteins in same PDB: d2akwa_, d2akwb1, d2akwb2, d2akwb3, d2akwb4, d2akwb5 automated match to d1jjcb5 protein/RNA complex; complexed with 200, mn, so4 |
PDB Entry: 2akw (more details), 2.8 Å
SCOPe Domain Sequences for d2akwb6:
Sequence; same for both SEQRES and ATOM records: (download)
>d2akwb6 d.104.1.1 (B:475-681) Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain {Thermus thermophilus [TaxId: 274]} alpaffpapdnrgveapyrkeqrlrevlsglgfqevytysfmdpedarrfrldpprllll nplapekaalrthlfpglvrvlkenldldrperallfevgrvfrereethlagllfgegv glpwakerlsgyfllkgylealfarlglafrveaqafpflhpgvsgrvlvegeevgflga lhpeiaqelelppvhlfelrlplpdkp
Timeline for d2akwb6: