SCOPe 2.08: Domain d2ahoa1: 2aho A:207-320

Lineage for d2ahoa1 (2aho A:207-320)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (7 families)

5. Family b.43.3.1: Elongation factors [50448] (11 proteins)

6. Protein Initiation factor eIF2 gamma subunit, domain II [74962] (3 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [141335] (10 PDB entries)
   Uniprot Q980A5 207-320

8. Domain d2ahoa1: 2aho A:207-320 [126767]
   Other proteins in same PDB: d2ahoa2, d2ahoa3, d2ahob1, d2ahob2, d2ahob3
   complexed with gnp, mg, zn

Details for d2ahoa1

PDB Entry: 2aho, 3 Å

PDB Description: structure of the archaeal initiation factor eif2 alpha-gamma heterodimer from sulfolobus solfataricus complexed with gdpnp

PDB Compounds: (A:) Translation initiation factor 2 gamma subunit

SCOPe Domain Sequences for d2ahoa1:

Sequence, based on SEQRES records:

>d2ahoa1 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]}
rdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkvdqeikvlpglrvekqgk
vsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadnllgsiitlad

Sequence, based on observed residues (ATOM records):

>d2ahoa1 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]}
rdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkvdqeikvlpglrvvsyep
iftkissirfgdeefkeakpgglvaigtyldpsltkadnllgsiitlad

Timeline for d2ahoa1:

• d2ahoa1 first appeared in SCOP 1.73
  
• d2ahoa1 appears in SCOPe 2.07