SCOPe 2.08: Domain d2ahob3: 2aho B:176-264

Lineage for d2ahob3 (2aho B:176-264)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.51: eIF-2-alpha, C-terminal domain [110993] (1 family)

5. Family d.58.51.1: eIF-2-alpha, C-terminal domain [110994] (1 protein)

6. Protein eIF-2-alpha, C-terminal domain [110995] (2 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [143409] (4 PDB entries)
   Uniprot Q97Z79 176-264

8. Domain d2ahob3: 2aho B:176-264 [126772]
   Other proteins in same PDB: d2ahoa1, d2ahoa2, d2ahoa3, d2ahob1, d2ahob2
   complexed with gnp, mg, zn

Details for d2ahob3

PDB Entry: 2aho, 3 Å

PDB Description: structure of the archaeal initiation factor eif2 alpha-gamma heterodimer from sulfolobus solfataricus complexed with gdpnp

PDB Compounds: (B:) Translation initiation factor 2 alpha subunit

SCOPe Domain Sequences for d2ahob3:

Sequence; same for both SEQRES and ATOM records:

>d2ahob3 d.58.51.1 (B:176-264) eIF-2-alpha, C-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}
kvkmsglitvrtneplgvekikeviskalenieqdyesllnikiytigapryrvdvvgtn
pkeasealnqiisnlikigkeenvdisvv

Timeline for d2ahob3:

• d2ahob3 first appeared in SCOP 1.73
  
• d2ahob3 appears in SCOPe 2.07