Lineage for d2ahob3 (2aho B:176-264)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2522526Superfamily d.58.51: eIF-2-alpha, C-terminal domain [110993] (1 family) (S)
  5. 2522527Family d.58.51.1: eIF-2-alpha, C-terminal domain [110994] (1 protein)
  6. 2522528Protein eIF-2-alpha, C-terminal domain [110995] (2 species)
  7. 2522531Species Sulfolobus solfataricus [TaxId:2287] [143409] (4 PDB entries)
    Uniprot Q97Z79 176-264
  8. 2522537Domain d2ahob3: 2aho B:176-264 [126772]
    Other proteins in same PDB: d2ahoa1, d2ahoa2, d2ahoa3, d2ahob1, d2ahob2
    complexed with gnp, mg, zn

Details for d2ahob3

PDB Entry: 2aho (more details), 3 Å

PDB Description: structure of the archaeal initiation factor eif2 alpha-gamma heterodimer from sulfolobus solfataricus complexed with gdpnp
PDB Compounds: (B:) Translation initiation factor 2 alpha subunit

SCOPe Domain Sequences for d2ahob3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ahob3 d.58.51.1 (B:176-264) eIF-2-alpha, C-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}
kvkmsglitvrtneplgvekikeviskalenieqdyesllnikiytigapryrvdvvgtn
pkeasealnqiisnlikigkeenvdisvv

SCOPe Domain Coordinates for d2ahob3:

Click to download the PDB-style file with coordinates for d2ahob3.
(The format of our PDB-style files is described here.)

Timeline for d2ahob3: