Lineage for d2ahob1 (2aho B:85-175)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2716745Superfamily a.60.14: eIF2alpha middle domain-like [116742] (2 families) (S)
  5. 2716746Family a.60.14.1: eIF2alpha middle domain-like [116743] (1 protein)
  6. 2716747Protein Eukaryotic initiation factor 2alpha, eIF2alpha, domain 2 [116744] (3 species)
  7. 2716753Species Sulfolobus solfataricus [TaxId:2287] [140651] (2 PDB entries)
    Uniprot Q97Z79 85-175
  8. 2716758Domain d2ahob1: 2aho B:85-175 [126770]
    Other proteins in same PDB: d2ahoa1, d2ahoa2, d2ahoa3, d2ahob2, d2ahob3
    complexed with gnp, mg, zn

Details for d2ahob1

PDB Entry: 2aho (more details), 3 Å

PDB Description: structure of the archaeal initiation factor eif2 alpha-gamma heterodimer from sulfolobus solfataricus complexed with gdpnp
PDB Compounds: (B:) Translation initiation factor 2 alpha subunit

SCOPe Domain Sequences for d2ahob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ahob1 a.60.14.1 (B:85-175) Eukaryotic initiation factor 2alpha, eIF2alpha, domain 2 {Sulfolobus solfataricus [TaxId: 2287]}
vtdderrkknlqwkkiqrldkilelvsqklklsekdaweqvawkleakygdpitaiekav
kegekilidagvpeiwvkplleeaskhaeer

SCOPe Domain Coordinates for d2ahob1:

Click to download the PDB-style file with coordinates for d2ahob1.
(The format of our PDB-style files is described here.)

Timeline for d2ahob1: