PDB entry 2aho

View 2aho on RCSB PDB site
Description: Structure of the archaeal initiation factor eIF2 alpha-gamma heterodimer from Sulfolobus solfataricus complexed with GDPNP
Class: translation
Keywords: initiation of translation, TRANSLATION
Deposited on 2005-07-28, released 2006-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translation initiation factor 2 gamma subunit
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ahoa1, d2ahoa2, d2ahoa3
  • Chain 'B':
    Compound: Translation initiation factor 2 alpha subunit
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ahob1, d2ahob2, d2ahob3
  • Heterogens: MG, ZN, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ahoA (A:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
    ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
    epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
    pvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggviggs
    iiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigtyl
    dpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmlsv
    gssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ahoA (A:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtsgmtiklgyaetnigvcesckkpeayv
    tepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaanepfpqpqt
    rehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiipvsalhki
    nidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkv
    dqeikvlpglrvvsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadnllgs
    iitladaevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivtsvk
    kdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ahoB (B:)
    miysrsklpsegeiliatvkqvfdygsyvsldeygglqaflpwsevsskwvknirdvlke
    nrkvivkvirvdrrkgtvdvslkkvtdderrkknlqwkkiqrldkilelvsqklklsekd
    aweqvawkleakygdpitaiekavkegekilidagvpeiwvkplleeaskhaeerkvkms
    glitvrtneplgvekikeviskalenieqdyesllnikiytigapryrvdvvgtnpkeas
    ealnqiisnlikigkeenvdisvvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ahoB (B:)
    miysrsklpsegeiliatvkqvfdygsyvsldeygglqaflpwsevsnirdvlkenrkvi
    vkvirvdrrkgtvdvslkkvtdderrkknlqwkkiqrldkilelvsqklklsekdaweqv
    awkleakygdpitaiekavkegekilidagvpeiwvkplleeaskhaeerkvkmsglitv
    rtneplgvekikeviskalenieqdyesllnikiytigapryrvdvvgtnpkeasealnq
    iisnlikigkeenvdisvv