SCOPe 2.08: Domain d2ahba1: 2ahb A:1-184

Lineage for d2ahba1 (2ahb A:1-184)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)

6. Protein Ketoacyl-ACP synthase III (FabH) [53912] (5 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [64196] (12 PDB entries)

8. Domain d2ahba1: 2ahb A:1-184 [126744]
   automated match to d2qnza1
   mutant

Details for d2ahba1

PDB Entry: 2ahb, 2 Å

PDB Description: x-ray crystal structure of r46a,r161a mutant of mycobacterium tuberculosis fabh

PDB Compounds: (A:) Beta- ketoacyl-ACP synthase III

SCOPe Domain Sequences for d2ahba1:

Sequence; same for both SEQRES and ATOM records:

>d2ahba1 c.95.1.2 (A:1-184) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]}
mteiattsgarsvgllsvgayrpervvtndeicqhidssdewiytatgiktrrfaaddes
aasmateacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsa
gcagfgyalgaaadmirgggaatmlvvgteklsptidmydagncfifadgaaavvvgetp
fqgi

Timeline for d2ahba1:

• d2ahba1 first appeared in SCOP 1.73
  
• d2ahba1 appears in SCOPe 2.07