PDB entry 2ahb

View 2ahb on RCSB PDB site
Description: X-ray crystal structure of R46A,R161A mutant of Mycobacterium tuberculosis FabH
Class: transferase
Keywords: 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE III, BETA-KETOACYL-ACYL CARRIER PROTEIN SYNTHASE III, mtFabH, FabH, transferase
Deposited on 2005-07-27, released 2005-08-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta- ketoacyl-ACP synthase III
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: fabH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A574 (21-End)
      • engineered (66)
      • engineered (181)
    Domains in SCOPe 2.07: d2ahba1, d2ahba2
  • Chain 'B':
    Compound: Beta- ketoacyl-ACP synthase III
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: fabH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A574 (21-End)
      • engineered (66)
      • engineered (181)
    Domains in SCOPe 2.07: d2ahbb1, d2ahbb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ahbA (A:)
    mgsshhhhhhssglvprgsvcmteiattsgarsvgllsvgayrpervvtndeicqhidss
    dewiytatgiktrrfaaddesaasmateacrralsnaglsaadidgvivttnthflqtpp
    aapmvaaslgakgilgfdlsagcagfgyalgaaadmirgggaatmlvvgteklsptidmy
    dagncfifadgaaavvvgetpfqgigptvagsdgeqadairqdidwitfaqnpsgprpfv
    rlegpavfrwaafkmgdvgrramdaagvrpdqidvfvphqansrinellvknlqlrpdav
    vandiehtgntsaasiplamaellttgaakpgdlalligygaglsyaaqvvrmpkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ahbA (A:)
    mteiattsgarsvgllsvgayrpervvtndeicqhidssdewiytatgiktrrfaaddes
    aasmateacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsa
    gcagfgyalgaaadmirgggaatmlvvgteklsptidmydagncfifadgaaavvvgetp
    fqgigptvagsdgeqadairqdidwitfaqnpsgprpfvrlegpavfrwaafkmgdvgrr
    amdaagvrpdqidvfvphqansrinellvknlqlrpdavvandiehtgntsaasiplama
    ellttgaakpgdlalligygaglsyaaqvvrmpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ahbB (B:)
    mgsshhhhhhssglvprgsvcmteiattsgarsvgllsvgayrpervvtndeicqhidss
    dewiytatgiktrrfaaddesaasmateacrralsnaglsaadidgvivttnthflqtpp
    aapmvaaslgakgilgfdlsagcagfgyalgaaadmirgggaatmlvvgteklsptidmy
    dagncfifadgaaavvvgetpfqgigptvagsdgeqadairqdidwitfaqnpsgprpfv
    rlegpavfrwaafkmgdvgrramdaagvrpdqidvfvphqansrinellvknlqlrpdav
    vandiehtgntsaasiplamaellttgaakpgdlalligygaglsyaaqvvrmpkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ahbB (B:)
    mteiattsgarsvgllsvgayrpervvtndeicqhidssdewiytatgiktrrfaaddes
    aasmateacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsa
    gcagfgyalgaaadmirgggaatmlvvgteklsptidmydagncfifadgaaavvvgetp
    fqgigptvagsdgeqadairqdidwitfaqnpsgprpfvrlegpavfrwaafkmgdvgrr
    amdaagvrpdqidvfvphqansrinellvknlqlrpdavvandiehtgntsaasiplama
    ellttgaakpgdlalligygaglsyaaqvvrmpk