Lineage for d2qnza1 (2qnz A:-10-174)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.95: Thiolase-like [53900] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the restSuperfamily c.95.1: Thiolase-like [53901] (3 families) 
Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins) Protein Ketoacyl-ACP synthase III (FabH) [53912] (5 species) 
Species Mycobacterium tuberculosis [TaxId:1773] [64196] (12 PDB entries) 
Domain d2qnza1: 2qnz A:-10-174 [150964]
automated match to d1hzpa1
complexed with bme, dfd
Details for d2qnza1
PDB Entry: 2qnz (more details), 2.3 Å
PDB Description: Crystal structure of the complex between the mycobacterium beta-ketoacyl-acyl carrier protein synthase III (FABH) and SS-(2-hydroxyethyl)-O-decyl ester carbono(dithioperoxoic) acid
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 3SCOPe Domain Sequences for d2qnza1:
Sequence, based on SEQRES records: (download)
>d2qnza1 c.95.1.2 (A:-10-174) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]}
mteiattsgarsvgllsvgayrpervvtndeicqhidssdewiytrtgiktrrfaaddes
aasmateacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsa
gcagfgyalgaaadmirgggaatmlvvgteklsptidmydrgncfifadgaaavvvgetp
fqgi
Sequence, based on observed residues (ATOM records): (download)
>d2qnza1 c.95.1.2 (A:-10-174) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]}
mteiattsgarsvgllsvgayrpervvtndeicqsdewiytrtgiktrrfaaddesaasm
ateacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsagcag
fgyalgaaadmirgggaatmlvvgteklsptidmydrgncfifadgaaavvvgetpfqgi
SCOPe Domain Coordinates for d2qnza1:
Click to download the PDB-style file with coordinates for d2qnza1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2qnza1:
- d2qnza1 first appeared in SCOP 1.75
- d2qnza1 appears in SCOPe 2.07
View in 3D
