![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
![]() | Protein Dehydrogenase/reductase SDR family member 6, DHRS6 [141894] (1 species) Oxidoreductase UCPA |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141895] (1 PDB entry) Uniprot Q9BUT1 1-245 |
![]() | Domain d2ag5a1: 2ag5 A:1-245 [126719] Other proteins in same PDB: d2ag5a2, d2ag5b2, d2ag5b3, d2ag5c_, d2ag5d_ complexed with nad, so4 |
PDB Entry: 2ag5 (more details), 1.84 Å
SCOPe Domain Sequences for d2ag5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} mgrldgkviiltaaaqgigqaaalafaregakviatdinesklqelekypgiqtrvldvt kkkqidqfaneverldvlfnvagfvhhgtvldceekdwdfsmnlnvrsmylmikaflpkm laqksgniinmssvassvkgvvnrcvysttkaavigltksvaadfiqqgircncvcpgtv dtpslqeriqargnpeearndflkrqktgrfataeeiamlcvylasdesayvtgnpviid ggwsl
Timeline for d2ag5a1:
![]() Domains from other chains: (mouse over for more information) d2ag5b2, d2ag5b3, d2ag5c_, d2ag5d_ |