![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
![]() | Protein automated matches [190069] (319 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186944] (65 PDB entries) |
![]() | Domain d2ag5d_: 2ag5 D: [126722] Other proteins in same PDB: d2ag5a1, d2ag5a2, d2ag5b3 automated match to d1nffa_ complexed with nad, so4 |
PDB Entry: 2ag5 (more details), 1.84 Å
SCOPe Domain Sequences for d2ag5d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ag5d_ c.2.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} grldgkviiltaaaqgigqaaalafaregakviatdinesklqelekypgiqtrvldvtk kkqidqfaneverldvlfnvagfvhhgtvldceekdwdfsmnlnvrsmylmikaflpkml aqksgniinmssvassvkgvvnrcvysttkaavigltksvaadfiqqgircncvcpgtvd tpslqeriqargnpeearndflkrqktgrfataeeiamlcvylasdesayvtgnpviidg gwsl
Timeline for d2ag5d_: