Lineage for d2aeha3 (2aeh A:33-130)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2502379Family d.15.1.4: First domain of FERM [54256] (6 protein domains)
  6. 2502389Protein Focal adhesion kinase 1 [142960] (1 species)
  7. 2502390Species Chicken (Gallus gallus) [TaxId:9031] [142961] (2 PDB entries)
    Uniprot Q00944 31-130
  8. 2502393Domain d2aeha3: 2aeh A:33-130 [126627]
    Other proteins in same PDB: d2aeha1, d2aeha2, d2aehb1, d2aehb2
    automated match to d2al6b3

Details for d2aeha3

PDB Entry: 2aeh (more details), 2.53 Å

PDB Description: Focal adhesion kinase 1
PDB Compounds: (A:) Focal adhesion kinase 1

SCOPe Domain Sequences for d2aeha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aeha3 d.15.1.4 (A:33-130) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]}
mervlkvfhyfenssepttwasiirhgdatdvrgiiqkivdchkvknvacyglrlshlqs
eevhwlhldmgvsnvrekfelahppeewkyelrirylp

SCOPe Domain Coordinates for d2aeha3:

Click to download the PDB-style file with coordinates for d2aeha3.
(The format of our PDB-style files is described here.)

Timeline for d2aeha3: