![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.4: First domain of FERM [54256] (6 proteins) |
![]() | Protein Focal adhesion kinase 1 [142960] (1 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [142961] (2 PDB entries) Uniprot Q00944 31-130 |
![]() | Domain d2aeha3: 2aeh A:33-130 [126627] Other proteins in same PDB: d2aeha1, d2aeha2, d2aehb1, d2aehb2 automated match to d2al6b3 |
PDB Entry: 2aeh (more details), 2.53 Å
SCOPe Domain Sequences for d2aeha3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aeha3 d.15.1.4 (A:33-130) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]} mervlkvfhyfenssepttwasiirhgdatdvrgiiqkivdchkvknvacyglrlshlqs eevhwlhldmgvsnvrekfelahppeewkyelrirylp
Timeline for d2aeha3: