Lineage for d2aeha1 (2aeh A:131-253)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. Superfamily a.11.2: Second domain of FERM [47031] (2 families) (S)
    automatically mapped to Pfam PF00373
  5. Family a.11.2.1: Second domain of FERM [47032] (9 proteins)
  6. Protein Focal adhesion kinase 1 [140380] (1 species)
  7. Species Chicken (Gallus gallus) [TaxId:9031] [140381] (2 PDB entries)
    Uniprot Q00944 131-253
  8. Domain d2aeha1: 2aeh A:131-253 [126625]
    Other proteins in same PDB: d2aeha2, d2aeha3, d2aehb2, d2aehb3
    automated match to d2al6a1

Details for d2aeha1

PDB Entry: 2aeh (more details), 2.53 Å

PDB Description: Focal adhesion kinase 1
PDB Compounds: (A:) Focal adhesion kinase 1

SCOPe Domain Sequences for d2aeha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aeha1 a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]}
kgflnqftedkptlnffyqqvkndymleiadqvdqeialklgcleirrsygemrgnalek
ksnyevlekdvglrrffpkslldsvkaktlrkliqqtfrqfanlnreesilkffeilspv
yrf

SCOPe Domain Coordinates for d2aeha1 are not available.

Timeline for d2aeha1:

Domains from same chain:
(mouse over for more information)
d2aeha2, d2aeha3
Domains from other chains:
(mouse over for more information)
d2aehb1, d2aehb2, d2aehb3