Class a: All alpha proteins [46456] (290 folds) |
Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.11.2: Second domain of FERM [47031] (2 families) automatically mapped to Pfam PF00373 |
Family a.11.2.1: Second domain of FERM [47032] (9 proteins) |
Protein Focal adhesion kinase 1 [140380] (1 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [140381] (2 PDB entries) Uniprot Q00944 131-253 |
Domain d2aeha1: 2aeh A:131-253 [126625] Other proteins in same PDB: d2aeha2, d2aeha3, d2aehb2, d2aehb3 automated match to d2al6a1 |
PDB Entry: 2aeh (more details), 2.53 Å
SCOPe Domain Sequences for d2aeha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aeha1 a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]} kgflnqftedkptlnffyqqvkndymleiadqvdqeialklgcleirrsygemrgnalek ksnyevlekdvglrrffpkslldsvkaktlrkliqqtfrqfanlnreesilkffeilspv yrf
Timeline for d2aeha1: