SCOP 1.73: Domain d2aeha3: 2aeh A:33-130

Lineage for d2aeha3 (2aeh A:33-130)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (7 families)

5. Family d.15.1.4: First domain of FERM [54256] (6 proteins)

6. Protein Focal adhesion kinase 1 [142960] (1 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [142961] (2 PDB entries)

8. Domain d2aeha3: 2aeh A:33-130 [126627]
   Other proteins in same PDB: d2aeha1, d2aeha2, d2aehb1, d2aehb2
   automatically matched to 2AL6 A:31-130

Details for d2aeha3

PDB Entry: 2aeh, 2.53 Å

PDB Description: Focal adhesion kinase 1

PDB Compounds: (A:) Focal adhesion kinase 1

SCOP Domain Sequences for d2aeha3:

Sequence; same for both SEQRES and ATOM records:

>d2aeha3 d.15.1.4 (A:33-130) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]}
mervlkvfhyfenssepttwasiirhgdatdvrgiiqkivdchkvknvacyglrlshlqs
eevhwlhldmgvsnvrekfelahppeewkyelrirylp

Timeline for d2aeha3:

• d2aeha3 is new in SCOP 1.73
  
• d2aeha3 appears in SCOP 1.75
  
• d2aeha3 appears in the current release, SCOPe 2.08