SCOPe 2.08: Domain d2aehb2: 2aeh B:254-363

Lineage for d2aehb2 (2aeh B:254-363)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.5: Third domain of FERM [50776] (8 proteins)

6. Protein Focal adhesion kinase 1 [141432] (1 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [141433] (2 PDB entries)
   Uniprot Q00944 254-363

8. Domain d2aehb2: 2aeh B:254-363 [126629]
   Other proteins in same PDB: d2aeha1, d2aeha3, d2aehb1, d2aehb3
   automated match to d2al6a2

Details for d2aehb2

PDB Entry: 2aeh, 2.53 Å

PDB Description: Focal adhesion kinase 1

PDB Compounds: (B:) Focal adhesion kinase 1

SCOPe Domain Sequences for d2aehb2:

Sequence; same for both SEQRES and ATOM records:

>d2aehb2 b.55.1.5 (B:254-363) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]}
dkecfkcalgsswiisvelaigpeegisyltdkganpthladfnqvqtiqysnsedkdrk
gmlqlkiagapepltvtapsltiaenmadlidgycrlvngatqsfiirpq

Timeline for d2aehb2:

• d2aehb2 first appeared in SCOP 1.73
  
• d2aehb2 appears in SCOPe 2.07