SCOPe 2.04: Domain d2a6sd_: 2a6s D:

Lineage for d2a6sd_ (2a6s D:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.298: RelE-like [143010] (1 superfamily)
   beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432

4. Superfamily d.298.1: RelE-like [143011] (3 families)
   Toxin component of plasmid stabilisation system

5. Family d.298.1.1: YoeB/Txe-like [143012] (1 protein)
   Pfam PF06769

6. Protein Toxin YoeB [143013] (1 species)

7. Species Escherichia coli [TaxId:562] [143014] (3 PDB entries)
   Uniprot P69348 1-84

8. Domain d2a6sd_: 2a6s D: [126308]
   automated match to d2a6qe1
   complexed with ipa

Details for d2a6sd_

PDB Entry: 2a6s, 1.77 Å

PDB Description: crystal structure of yoeb under isopropanol condition

PDB Compounds: (D:) Toxin yoeB

SCOPe Domain Sequences for d2a6sd_:

Sequence; same for both SEQRES and ATOM records:

>d2a6sd_ d.298.1.1 (D:) Toxin YoeB {Escherichia coli [TaxId: 562]}
mkliwseeswddylywqetdkrivkkinelikdtrrtpfegkgkpeplkhnlsgfwsrri
teehrlvyavtddslliaacryh

Timeline for d2a6sd_:

• d2a6sd_ first appeared in SCOP 1.73, called d2a6sd1
  
• d2a6sd_ appears in SCOPe 2.03
  
• d2a6sd_ appears in SCOPe 2.05
  
• d2a6sd_ appears in the current release, SCOPe 2.08