Lineage for d2a6sa_ (2a6s A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1688581Fold d.298: RelE-like [143010] (1 superfamily)
    beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432
  4. 1688582Superfamily d.298.1: RelE-like [143011] (3 families) (S)
    Toxin component of plasmid stabilisation system
  5. 1688583Family d.298.1.1: YoeB/Txe-like [143012] (1 protein)
    Pfam PF06769
  6. 1688584Protein Toxin YoeB [143013] (1 species)
  7. 1688585Species Escherichia coli [TaxId:562] [143014] (3 PDB entries)
    Uniprot P69348 1-84
  8. 1688586Domain d2a6sa_: 2a6s A: [126305]
    automated match to d2a6qe1
    complexed with ipa

Details for d2a6sa_

PDB Entry: 2a6s (more details), 1.77 Å

PDB Description: crystal structure of yoeb under isopropanol condition
PDB Compounds: (A:) Toxin yoeB

SCOPe Domain Sequences for d2a6sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6sa_ d.298.1.1 (A:) Toxin YoeB {Escherichia coli [TaxId: 562]}
mkliwseeswddylywqetdkrivkkinelikdtrrtpfegkgkpeplkhnlsgfwsrri
teehrlvyavtddslliaacryh

SCOPe Domain Coordinates for d2a6sa_:

Click to download the PDB-style file with coordinates for d2a6sa_.
(The format of our PDB-style files is described here.)

Timeline for d2a6sa_: