Lineage for d2a6sd_ (2a6s D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010146Fold d.298: RelE-like [143010] (1 superfamily)
    beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432
  4. 3010147Superfamily d.298.1: RelE-like [143011] (3 families) (S)
    Toxin component of plasmid stabilisation system
  5. 3010148Family d.298.1.1: YoeB/Txe-like [143012] (2 proteins)
    Pfam PF06769
  6. 3010149Protein Toxin YoeB [143013] (1 species)
  7. 3010150Species Escherichia coli [TaxId:562] [143014] (3 PDB entries)
    Uniprot P69348 1-84
  8. 3010154Domain d2a6sd_: 2a6s D: [126308]
    automated match to d2a6qe1
    complexed with ipa

Details for d2a6sd_

PDB Entry: 2a6s (more details), 1.77 Å

PDB Description: crystal structure of yoeb under isopropanol condition
PDB Compounds: (D:) Toxin yoeB

SCOPe Domain Sequences for d2a6sd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6sd_ d.298.1.1 (D:) Toxin YoeB {Escherichia coli [TaxId: 562]}
mkliwseeswddylywqetdkrivkkinelikdtrrtpfegkgkpeplkhnlsgfwsrri
teehrlvyavtddslliaacryh

SCOPe Domain Coordinates for d2a6sd_:

Click to download the PDB-style file with coordinates for d2a6sd_.
(The format of our PDB-style files is described here.)

Timeline for d2a6sd_: