SCOP 1.73: Domain d2a6sd1: 2a6s D:1-83

Lineage for d2a6sd1 (2a6s D:1-83)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.298: RelE-like [143010] (1 superfamily)
   beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432

4. Superfamily d.298.1: RelE-like [143011] (2 families)
   Toxin component of plasmid stabilisation system

5. Family d.298.1.1: YoeB/Txe-like [143012] (1 protein)
   Pfam PF06769

6. Protein Toxin YoeB [143013] (1 species)

7. Species Escherichia coli [TaxId:562] [143014] (3 PDB entries)

8. Domain d2a6sd1: 2a6s D:1-83 [126308]
   automatically matched to 2A6Q E:1-84
   complexed with ipa

Details for d2a6sd1

PDB Entry: 2a6s, 1.77 Å

PDB Description: crystal structure of yoeb under isopropanol condition

PDB Compounds: (D:) Toxin yoeB

SCOP Domain Sequences for d2a6sd1:

Sequence; same for both SEQRES and ATOM records:

>d2a6sd1 d.298.1.1 (D:1-83) Toxin YoeB {Escherichia coli [TaxId: 562]}
mkliwseeswddylywqetdkrivkkinelikdtrrtpfegkgkpeplkhnlsgfwsrri
teehrlvyavtddslliaacryh

Timeline for d2a6sd1:

• d2a6sd1 is new in SCOP 1.73
  
• d2a6sd1 appears in SCOP 1.75
  
• d2a6sd1 appears in the current release, SCOPe 2.08, called d2a6sd_