Lineage for d2a5ta_ (2a5t A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1185373Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1185374Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1185375Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1185914Protein N-methyl-D-aspartate receptor subunit 1 [89787] (2 species)
  7. 1185915Species Norway rat (Rattus norvegicus) [TaxId:10116] [89788] (8 PDB entries)
  8. 1185925Domain d2a5ta_: 2a5t A: [126179]
    Other proteins in same PDB: d2a5tb_
    automated match to d1pb7a_
    complexed with glu, gly

Details for d2a5ta_

PDB Entry: 2a5t (more details), 2 Å

PDB Description: crystal structure of the nr1/nr2a ligand-binding cores complex
PDB Compounds: (A:) N-methyl-D-aspartate receptor NMDAR1-4a subunit

SCOPe Domain Sequences for d2a5ta_:

Sequence, based on SEQRES records: (download)

>d2a5ta_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
trlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgpndtspgsprhtvpqcc
ygfcidlliklartmnftyevhlvadgkfgtqervnnsnkkewngmmgellsgqadmiva
pltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdi
yfrrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttge
lffrsgfgigmrkdspwkqnvslsilkshengfmedldktwvry

Sequence, based on observed residues (ATOM records): (download)

>d2a5ta_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
trlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgpntvpqccygfcidlli
klartmnftyevhlvadgkfgtqervkkewngmmgellsgqadmivapltinneraqyie
fskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdiyfrrqvelstmyr
hmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgelffrsgfgigmrk
dspwkqnvslsilkshengfmedldktwvry

SCOPe Domain Coordinates for d2a5ta_:

Click to download the PDB-style file with coordinates for d2a5ta_.
(The format of our PDB-style files is described here.)

Timeline for d2a5ta_: