Lineage for d2a5ta1 (2a5t A:5-285)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710610Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 710611Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 710612Family c.94.1.1: Phosphate binding protein-like [53851] (35 proteins)
  6. 711002Protein N-methyl-D-aspartate receptor subunit 1 [89787] (2 species)
  7. 711003Species Rat (Rattus norvegicus) [TaxId:10116] [89788] (8 PDB entries)
  8. 711013Domain d2a5ta1: 2a5t A:5-285 [126179]
    automatically matched to d1pb7a_
    complexed with glu, gly

Details for d2a5ta1

PDB Entry: 2a5t (more details), 2 Å

PDB Description: crystal structure of the nr1/nr2a ligand-binding cores complex
PDB Compounds: (A:) N-methyl-D-aspartate receptor NMDAR1-4a subunit

SCOP Domain Sequences for d2a5ta1:

Sequence, based on SEQRES records: (download)

>d2a5ta1 c.94.1.1 (A:5-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]}
rlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgpndtspgsprhtvpqccy
gfcidlliklartmnftyevhlvadgkfgtqervnnsnkkewngmmgellsgqadmivap
ltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdiy
frrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgel
ffrsgfgigmrkdspwkqnvslsilkshengfmedldktwv

Sequence, based on observed residues (ATOM records): (download)

>d2a5ta1 c.94.1.1 (A:5-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]}
rlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgpntvpqccygfcidllik
lartmnftyevhlvadgkfgtqervkkewngmmgellsgqadmivapltinneraqyief
skpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdiyfrrqvelstmyrh
mekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgelffrsgfgigmrkd
spwkqnvslsilkshengfmedldktwv

SCOP Domain Coordinates for d2a5ta1:

Click to download the PDB-style file with coordinates for d2a5ta1.
(The format of our PDB-style files is described here.)

Timeline for d2a5ta1: