Lineage for d2a4nb_ (2a4n B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209198Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2209213Protein Aminoglycoside 6'-N-acetyltransferase [55731] (1 species)
  7. 2209214Species Enterococcus faecium [TaxId:1352] [55732] (4 PDB entries)
  8. 2209220Domain d2a4nb_: 2a4n B: [126160]
    automated match to d1b87a_
    complexed with coa, so4

Details for d2a4nb_

PDB Entry: 2a4n (more details), 2.2 Å

PDB Description: crystal structure of aminoglycoside 6'-n-acetyltransferase complexed with coenzyme a
PDB Compounds: (B:) aac(6')-Ii

SCOPe Domain Sequences for d2a4nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a4nb_ d.108.1.1 (B:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]}
miisefdrnnpvlkdqlsdllrltwpeeygdssaeeveemmnperiavaavdqdelvgfi
gaipqygitgwelhplvvessrrknqigtrlvnylekevasrggitiylgtddldhgttl
sqtdlyehtfdkvasiqnlrehpyefyeklgykivgvlpnangwdkpdiwmaktiiprp

SCOPe Domain Coordinates for d2a4nb_:

Click to download the PDB-style file with coordinates for d2a4nb_.
(The format of our PDB-style files is described here.)

Timeline for d2a4nb_: