SCOPe 2.08: Domain d2a4nb_: 2a4n B:

Lineage for d2a4nb_ (2a4n B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein Aminoglycoside 6'-N-acetyltransferase [55731] (1 species)

7. Species Enterococcus faecium [TaxId:1352] [55732] (5 PDB entries)

8. Domain d2a4nb_: 2a4n B: [126160]
   automated match to d1b87a_
   complexed with coa, so4

Details for d2a4nb_

PDB Entry: 2a4n, 2.2 Å

PDB Description: crystal structure of aminoglycoside 6'-n-acetyltransferase complexed with coenzyme a

PDB Compounds: (B:) aac(6')-Ii

SCOPe Domain Sequences for d2a4nb_:

Sequence; same for both SEQRES and ATOM records:

>d2a4nb_ d.108.1.1 (B:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]}
miisefdrnnpvlkdqlsdllrltwpeeygdssaeeveemmnperiavaavdqdelvgfi
gaipqygitgwelhplvvessrrknqigtrlvnylekevasrggitiylgtddldhgttl
sqtdlyehtfdkvasiqnlrehpyefyeklgykivgvlpnangwdkpdiwmaktiiprp

Timeline for d2a4nb_:

• d2a4nb_ first appeared in SCOP 1.73, called d2a4nb1
  
• d2a4nb_ appears in SCOPe 2.07