SCOP 1.73: Domain d2a4nb1: 2a4n B:1-179

Lineage for d2a4nb1 (2a4n B:1-179)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins)

6. Protein Aminoglycoside 6'-N-acetyltransferase [55731] (1 species)

7. Species Enterococcus faecium [TaxId:1352] [55732] (3 PDB entries)

8. Domain d2a4nb1: 2a4n B:1-179 [126160]
   automatically matched to d1b87a_
   complexed with coa, so4

Details for d2a4nb1

PDB Entry: 2a4n, 2.2 Å

PDB Description: crystal structure of aminoglycoside 6'-n-acetyltransferase complexed with coenzyme a

PDB Compounds: (B:) aac(6')-Ii

SCOP Domain Sequences for d2a4nb1:

Sequence; same for both SEQRES and ATOM records:

>d2a4nb1 d.108.1.1 (B:1-179) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]}
miisefdrnnpvlkdqlsdllrltwpeeygdssaeeveemmnperiavaavdqdelvgfi
gaipqygitgwelhplvvessrrknqigtrlvnylekevasrggitiylgtddldhgttl
sqtdlyehtfdkvasiqnlrehpyefyeklgykivgvlpnangwdkpdiwmaktiiprp

Timeline for d2a4nb1:

• d2a4nb1 is new in SCOP 1.73
  
• d2a4nb1 appears in SCOP 1.75
  
• d2a4nb1 appears in the current release, SCOPe 2.08, called d2a4nb_