SCOPe 2.08: Domain d2a0ld1: 2a0l D:1-116

Lineage for d2a0ld1 (2a0l D:1-116)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 7.1 [TaxId:10090] [88557] (40 PDB entries)
   Uniprot P18532 # HV61_MOUSE Ig heavy chain V region 1B43 precursor

8. Domain d2a0ld1: 2a0l D:1-116 [125957]
   Other proteins in same PDB: d2a0la1, d2a0lb1, d2a0lc1, d2a0le1
   automatically matched to d1orsb1
   complexed with k

Details for d2a0ld1

PDB Entry: 2a0l, 3.9 Å

PDB Description: Crystal structure of KvAP-33H1 Fv complex

PDB Compounds: (D:) 33H1 Fv fragment

SCOPe Domain Sequences for d2a0ld1:

Sequence; same for both SEQRES and ATOM records:

>d2a0ld1 b.1.1.1 (D:1-116) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]}
dvqlqesgpglvkpsqslsltctvtgysitnnyawnwirqfpgnklewmgyinysgttsy
npslksrisitrdtsknqfflqlnsvttedtatyfcvrgydyfamdywgqgtsvtv

Timeline for d2a0ld1:

• d2a0ld1 first appeared in SCOP 1.73
  
• d2a0ld1 appears in SCOPe 2.07