Lineage for d2a0le1 (2a0l E:1-105)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2741196Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88527] (13 PDB entries)
  8. 2741214Domain d2a0le1: 2a0l E:1-105 [125958]
    Other proteins in same PDB: d2a0la1, d2a0lb1, d2a0ld1, d2a0lf1
    automatically matched to d1orsa1
    complexed with k

Details for d2a0le1

PDB Entry: 2a0l (more details), 3.9 Å

PDB Description: Crystal structure of KvAP-33H1 Fv complex
PDB Compounds: (E:) 33H1 Fv fragment

SCOPe Domain Sequences for d2a0le1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a0le1 b.1.1.1 (E:1-105) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
qivltqspaimsaslgdrvtmtctasssvsssylhwyqqkpgsspklwiystsnlasgvp
arfsgsgsgtsysltissmeaedaatyychqfhrsltfgsgtkle

SCOPe Domain Coordinates for d2a0le1:

Click to download the PDB-style file with coordinates for d2a0le1.
(The format of our PDB-style files is described here.)

Timeline for d2a0le1: