PDB entry 2a0l

View 2a0l on RCSB PDB site
Description: Crystal structure of KvAP-33H1 Fv complex
Class: Membrane Protein
Keywords: voltage sensor, voltage-dependent K+ channel, K+ channel-Fv complex, membrane protein, ion channel
Deposited on 2005-06-16, released 2005-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.9 Å
R-factor: 0.358
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Voltage-gated potassium channel
    Species: Aeropyrum pernix [TaxId:56636]
    Gene: KVAP_AERPE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a0la1
  • Chain 'B':
    Compound: Voltage-gated potassium channel
    Species: Aeropyrum pernix [TaxId:56636]
    Gene: KVAP_AERPE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2a0lb1
  • Chain 'C':
    Compound: 33H1 Fv fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2A0L (0-104)
    Domains in SCOPe 2.07: d2a0lc1
  • Chain 'D':
    Compound: 33H1 Fv fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2A0L (0-115)
    Domains in SCOPe 2.07: d2a0ld1
  • Chain 'E':
    Compound: 33H1 Fv fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2A0L (0-104)
    Domains in SCOPe 2.07: d2a0le1
  • Chain 'F':
    Compound: 33H1 Fv fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2A0L (0-115)
    Domains in SCOPe 2.07: d2a0lf1
  • Heterogens: K

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a0lA (A:)
    lglsdlggrvrnigdvmehplvelgvsyaallsvivvvveytmqlsgeylvrlylvdlil
    viilwadyayrayksgdpagyvkktlyeipalvpagllalieghlaglglfrlvrllrfl
    rilliisrgskflsaiadaadkirfyhlfgavmltvlygafaiyiveypdpnssiksvfd
    alwwavvtattvgygdvvpatpigkvigiavmltgisaltlligtvsnmfqkilvgepep
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a0lA (A:)
    hplvelgvsyaallsvivvvveytmqlsgeylvrlylvdlilviilwadyayrayksgdp
    agyvkktlyeipalvpagllalieghlaglglfrlvrllrflrilliisrgskflsaiad
    aadkirfyhlfgavmltvlygafaiyiveypdpnssiksvfdalwwavvtattvgygdvv
    patpigkvigiavmltgisaltlligtvsnmfqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a0lB (B:)
    lglsdlggrvrnigdvmehplvelgvsyaallsvivvvveytmqlsgeylvrlylvdlil
    viilwadyayrayksgdpagyvkktlyeipalvpagllalieghlaglglfrlvrllrfl
    rilliisrgskflsaiadaadkirfyhlfgavmltvlygafaiyiveypdpnssiksvfd
    alwwavvtattvgygdvvpatpigkvigiavmltgisaltlligtvsnmfqkilvgepep
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a0lB (B:)
    hplvelgvsyaallsvivvvveytmqlsgeylvrlylvdlilviilwadyayrayksgdp
    agyvkktlyeipalvpagllalieghlaglglfrlvrllrflrilliisrgskflsaiad
    aadkirfyhlfgavmltvlygafaiyiveypdpnssiksvfdalwwavvtattvgygdvv
    patpigkvigiavmltgisaltlligtvsnmfqk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a0lC (C:)
    qivltqspaimsaslgdrvtmtctasssvsssylhwyqqkpgsspklwiystsnlasgvp
    arfsgsgsgtsysltissmeaedaatyychqfhrsltfgsgtkle
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a0lD (D:)
    dvqlqesgpglvkpsqslsltctvtgysitnnyawnwirqfpgnklewmgyinysgttsy
    npslksrisitrdtsknqfflqlnsvttedtatyfcvrgydyfamdywgqgtsvtv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a0lE (E:)
    qivltqspaimsaslgdrvtmtctasssvsssylhwyqqkpgsspklwiystsnlasgvp
    arfsgsgsgtsysltissmeaedaatyychqfhrsltfgsgtkle
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a0lF (F:)
    dvqlqesgpglvkpsqslsltctvtgysitnnyawnwirqfpgnklewmgyinysgttsy
    npslksrisitrdtsknqfflqlnsvttedtatyfcvrgydyfamdywgqgtsvtv