Lineage for d2a0ld1 (2a0l D:1-116)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352672Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2353538Species Mouse (Mus musculus), cluster 7.1 [TaxId:10090] [88557] (39 PDB entries)
    Uniprot P18532 # HV61_MOUSE Ig heavy chain V region 1B43 precursor
  8. 2353584Domain d2a0ld1: 2a0l D:1-116 [125957]
    Other proteins in same PDB: d2a0la1, d2a0lb1, d2a0lc1, d2a0le1
    automatically matched to d1orsb1
    complexed with k

Details for d2a0ld1

PDB Entry: 2a0l (more details), 3.9 Å

PDB Description: Crystal structure of KvAP-33H1 Fv complex
PDB Compounds: (D:) 33H1 Fv fragment

SCOPe Domain Sequences for d2a0ld1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a0ld1 b.1.1.1 (D:1-116) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]}
dvqlqesgpglvkpsqslsltctvtgysitnnyawnwirqfpgnklewmgyinysgttsy
npslksrisitrdtsknqfflqlnsvttedtatyfcvrgydyfamdywgqgtsvtv

SCOPe Domain Coordinates for d2a0ld1:

Click to download the PDB-style file with coordinates for d2a0ld1.
(The format of our PDB-style files is described here.)

Timeline for d2a0ld1: