![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
![]() | Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) ![]() Pfam PF00520 |
![]() | Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
![]() | Protein Potassium channel KVAP [90107] (1 species) |
![]() | Species Aeropyrum pernix [TaxId:56636] [90108] (3 PDB entries) |
![]() | Domain d2a0lb1: 2a0l B:24-237 [144782] Other proteins in same PDB: d2a0lc1, d2a0ld1, d2a0le1, d2a0lf1 automatically matched to 2A0L A:24-237 complexed with k has additional subdomain(s) that are not in the common domain |
PDB Entry: 2a0l (more details), 3.9 Å
SCOPe Domain Sequences for d2a0lb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a0lb1 f.14.1.1 (B:24-237) Potassium channel KVAP {Aeropyrum pernix [TaxId: 56636]} hplvelgvsyaallsvivvvveytmqlsgeylvrlylvdlilviilwadyayrayksgdp agyvkktlyeipalvpagllalieghlaglglfrlvrllrflrilliisrgskflsaiad aadkirfyhlfgavmltvlygafaiyiveypdpnssiksvfdalwwavvtattvgygdvv patpigkvigiavmltgisaltlligtvsnmfqk
Timeline for d2a0lb1: