Lineage for d2a0lb1 (2a0l B:24-237)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3023597Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 3023598Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) (S)
    Pfam PF00520
  5. 3023599Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 3023614Protein Potassium channel KVAP [90107] (1 species)
  7. 3023615Species Aeropyrum pernix [TaxId:56636] [90108] (3 PDB entries)
  8. 3023619Domain d2a0lb1: 2a0l B:24-237 [144782]
    Other proteins in same PDB: d2a0lc1, d2a0ld1, d2a0le1, d2a0lf1
    automatically matched to 2A0L A:24-237
    complexed with k

    has additional subdomain(s) that are not in the common domain

Details for d2a0lb1

PDB Entry: 2a0l (more details), 3.9 Å

PDB Description: Crystal structure of KvAP-33H1 Fv complex
PDB Compounds: (B:) Voltage-gated potassium channel

SCOPe Domain Sequences for d2a0lb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a0lb1 f.14.1.1 (B:24-237) Potassium channel KVAP {Aeropyrum pernix [TaxId: 56636]}
hplvelgvsyaallsvivvvveytmqlsgeylvrlylvdlilviilwadyayrayksgdp
agyvkktlyeipalvpagllalieghlaglglfrlvrllrflrilliisrgskflsaiad
aadkirfyhlfgavmltvlygafaiyiveypdpnssiksvfdalwwavvtattvgygdvv
patpigkvigiavmltgisaltlligtvsnmfqk

SCOPe Domain Coordinates for d2a0lb1:

Click to download the PDB-style file with coordinates for d2a0lb1.
(The format of our PDB-style files is described here.)

Timeline for d2a0lb1: