Lineage for d1zyrk2 (1zyr K:50-172)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
    automatically mapped to Pfam PF01000
  5. Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins)
  6. Protein RNA polymerase alpha subunit [56555] (3 species)
  7. Species Thermus thermophilus [TaxId:274] [75595] (16 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. Domain d1zyrk2: 1zyr K:50-172 [125860]
    Other proteins in same PDB: d1zyra1, d1zyrb1, d1zyrc_, d1zyrd_, d1zyre_, d1zyrf1, d1zyrf2, d1zyrf3, d1zyrk1, d1zyrl1, d1zyrm_, d1zyrn_, d1zyro_, d1zyrp1, d1zyrp2, d1zyrp3
    automatically matched to d1iw7a2
    protein/RNA complex; complexed with mg, std, zn

Details for d1zyrk2

PDB Entry: 1zyr (more details), 3 Å

PDB Description: Structure of Thermus thermophilus RNA polymerase holoenzyme in complex with the antibiotic streptolydigin
PDB Compounds: (K:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d1zyrk2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zyrk2 d.181.1.1 (K:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

SCOPe Domain Coordinates for d1zyrk2 are not available.

Timeline for d1zyrk2:

Domains from same chain:
(mouse over for more information)
d1zyrk1
Domains from other chains:
(mouse over for more information)
d1zyra1, d1zyra2, d1zyrb1, d1zyrb2, d1zyrc_, d1zyrd_, d1zyre_, d1zyrf1, d1zyrf2, d1zyrf3, d1zyrl1, d1zyrl2, d1zyrm_, d1zyrn_, d1zyro_, d1zyrp1, d1zyrp2, d1zyrp3