SCOPe 2.08: Domain d1zyrb1: 1zyr B:1-49,B:173-229

Lineage for d1zyrb1 (1zyr B:1-49,B:173-229)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families)
   form homo and heterodimers

5. Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (3 proteins)

6. Protein RNA polymerase alpha [55259] (3 species)

7. Species Thermus thermophilus [TaxId:274] [75478] (16 PDB entries)
   Uniprot Q9Z9H6; part of multichain biological unit

8. Domain d1zyrb1: 1zyr B:1-49,B:173-229 [125851]
   Other proteins in same PDB: d1zyra2, d1zyrb2, d1zyrc_, d1zyrd_, d1zyre_, d1zyrf1, d1zyrf2, d1zyrf3, d1zyrk2, d1zyrl2, d1zyrm_, d1zyrn_, d1zyro_, d1zyrp1, d1zyrp2, d1zyrp3
   automatically matched to d1iw7a1
   protein/RNA complex; complexed with mg, std, zn

Details for d1zyrb1

PDB Entry: 1zyr, 3 Å

PDB Description: Structure of Thermus thermophilus RNA polymerase holoenzyme in complex with the antibiotic streptolydigin

PDB Compounds: (B:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d1zyrb1:

Sequence; same for both SEQRES and ATOM records:

>d1zyrb1 d.74.3.1 (B:1-49,B:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]}
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve
dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq

Timeline for d1zyrb1:

• d1zyrb1 first appeared in SCOP 1.73
  
• d1zyrb1 appears in SCOPe 2.07