Lineage for d1zyrf3 (1zyr F:74-257)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735969Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily)
    multihelical; consists of a conserved 4-helical core and a variable insert subdomain
  4. 2735970Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) (S)
  5. 2735971Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (6 proteins)
  6. 2736017Protein automated matches [254474] (3 species)
    not a true protein
  7. 2736021Species Thermus thermophilus [TaxId:274] [255020] (2 PDB entries)
  8. 2736023Domain d1zyrf3: 1zyr F:74-257 [125858]
    Other proteins in same PDB: d1zyra1, d1zyra2, d1zyrb1, d1zyrb2, d1zyrc_, d1zyrd_, d1zyre_, d1zyrf1, d1zyrf2, d1zyrk1, d1zyrk2, d1zyrl1, d1zyrl2, d1zyrm_, d1zyrn_, d1zyro_, d1zyrp1, d1zyrp2
    automated match to d1smyf3
    protein/RNA complex; complexed with mg, std, zn

Details for d1zyrf3

PDB Entry: 1zyr (more details), 3 Å

PDB Description: Structure of Thermus thermophilus RNA polymerase holoenzyme in complex with the antibiotic streptolydigin
PDB Compounds: (F:) DNA-directed RNA polymerase sigma chain

SCOPe Domain Sequences for d1zyrf3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zyrf3 a.177.1.1 (F:74-257) automated matches {Thermus thermophilus [TaxId: 274]}
kistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvra
kilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlr
lvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiad
qart

SCOPe Domain Coordinates for d1zyrf3:

Click to download the PDB-style file with coordinates for d1zyrf3.
(The format of our PDB-style files is described here.)

Timeline for d1zyrf3: