![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
![]() | Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) ![]() the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
![]() | Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins) 4 helices; irregular array |
![]() | Protein RNA polymerase omega subunit [63564] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [74729] (11 PDB entries) Uniprot Q8RQE7; part of multichain biological unit |
![]() | Domain d1zyro_: 1zyr O: [125865] Other proteins in same PDB: d1zyra1, d1zyra2, d1zyrb1, d1zyrb2, d1zyrc_, d1zyrd_, d1zyrf1, d1zyrf2, d1zyrf3, d1zyrk1, d1zyrk2, d1zyrl1, d1zyrl2, d1zyrm_, d1zyrn_, d1zyrp1, d1zyrp2, d1zyrp3 automated match to d1i6ve_ protein/RNA complex; complexed with mg, std, zn |
PDB Entry: 1zyr (more details), 3 Å
SCOPe Domain Sequences for d1zyro_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zyro_ a.143.1.1 (O:) RNA polymerase omega subunit {Thermus thermophilus [TaxId: 274]} aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae twamkelltgrlvfgenlvpedrlqkemeriypge
Timeline for d1zyro_: