Lineage for d1zyrd_ (1zyr D:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2574250Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 2574251Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 2574346Family e.29.1.2: RNA-polymerase beta-prime [64490] (4 proteins)
  6. 2574414Protein automated matches [254473] (5 species)
    not a true protein
  7. 2574429Species Thermus thermophilus [TaxId:274] [255019] (2 PDB entries)
  8. 2574431Domain d1zyrd_: 1zyr D: [125854]
    Other proteins in same PDB: d1zyra1, d1zyra2, d1zyrb1, d1zyrb2, d1zyrc_, d1zyre_, d1zyrf1, d1zyrf2, d1zyrf3, d1zyrk1, d1zyrk2, d1zyrl1, d1zyrl2, d1zyrm_, d1zyro_, d1zyrp1, d1zyrp2, d1zyrp3
    automated match to d4g7od_
    protein/RNA complex; complexed with mg, std, zn

Details for d1zyrd_

PDB Entry: 1zyr (more details), 3 Å

PDB Description: Structure of Thermus thermophilus RNA polymerase holoenzyme in complex with the antibiotic streptolydigin
PDB Compounds: (D:) DNA-directed RNA polymerase subunit beta' chain

SCOPe Domain Sequences for d1zyrd_:

Sequence, based on SEQRES records: (download)

>d1zyrd_ e.29.1.2 (D:) automated matches {Thermus thermophilus [TaxId: 274]}
kkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacg
kykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsat
eleqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvkd
geevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpgei
laelpepylfraeeegvvelkeleegaflvlrredepvatyflpvgmtplvvhgeivekg
qplaeakgllrmprqvraaqveaeeegetvyltlflewtepkdyrvqphmnvvvpegarv
eagdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgdrvapgdvl
adggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldlealekelleem
khpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdln
dlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtnpgsdrplr
sltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkkm
eekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvlv
egqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplakp
srdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagretsvgrlky
vfanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavedekvaweliq
ldvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigiddavipeekk
qyleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfeenypfnply
vmaqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfisshgarkgg
adtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslrlrkradie
aglygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrspltcqtrygvc
qkcygydlsmarpvsigeavgivaaqsigepgtqltmrtfhtggvagaaditqglprvie
lfearrpkakaviseidgvvrieeteeklsvfvesegfskeyklpkearllvkdgdyvea
gqpltrgaidphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvrqmmkyvev
tdpgdsrllegqvlekwdvealnerliaegktpvawkpllmgvtksalstkswlsaasfq
ntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlkaieearke
avea

Sequence, based on observed residues (ATOM records): (download)

>d1zyrd_ e.29.1.2 (D:) automated matches {Thermus thermophilus [TaxId: 274]}
kkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacg
kykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsat
eleqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvkd
geevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpgei
laelpepylfgdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgd
rvapgdvladggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldleal
ekelleemkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdgg
rfatsdlndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtn
pgsdrplrsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelf
kpfllkkmeekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgi
qafqpvlvegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspa
sgeplakpsrdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagre
tsvgrlkyvfanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavede
kvaweliqldvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigidd
avipeekkqyleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfee
nypfnplyvmaqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfis
shgarkggadtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslr
lrkradieaglygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrsplt
cqtrygvcqkcygydlsmarpvsigeavgivaaqsigepgtqltmrtfhtggvagaadit
qglprvielfearrpkakaviseidgvvrieeteeklsvfvesegfskeyklpkearllv
kdgdyveagqpltrgaidphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvr
qmmkyvevtdpgdsrllegqvlekwdvealnerliaegktpvawkpllmgvtksalstks
wlsaasfqntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlk
aieearkeavea

SCOPe Domain Coordinates for d1zyrd_:

Click to download the PDB-style file with coordinates for d1zyrd_.
(The format of our PDB-style files is described here.)

Timeline for d1zyrd_: