Lineage for d1zrca1 (1zrc A:138-207)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1982239Family a.4.5.4: CAP C-terminal domain-like [46796] (9 protein domains)
  6. 1982240Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species)
    N-terminal domain has double beta-helix fold
  7. 1982241Species Escherichia coli [TaxId:562] [46798] (27 PDB entries)
  8. 1982280Domain d1zrca1: 1zrc A:138-207 [125531]
    Other proteins in same PDB: d1zrca2, d1zrcb2
    automated match to d1i5zb1
    protein/DNA complex; complexed with cmp

Details for d1zrca1

PDB Entry: 1zrc (more details), 2.8 Å

PDB Description: 4 crystal structures of cap-dna with all base-pair substitutions at position 6, cap-icap38 dna
PDB Compounds: (A:) Catabolite gene activator

SCOPe Domain Sequences for d1zrca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zrca1 a.4.5.4 (A:138-207) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvyg

SCOPe Domain Coordinates for d1zrca1:

Click to download the PDB-style file with coordinates for d1zrca1.
(The format of our PDB-style files is described here.)

Timeline for d1zrca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zrca2