SCOPe 2.08: Domain d1zrcb1: 1zrc B:138-207

Lineage for d1zrcb1 (1zrc B:138-207)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins)

6. Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species)
   N-terminal domain has double beta-helix fold

7. Species Escherichia coli [TaxId:562] [46798] (28 PDB entries)

8. Domain d1zrcb1: 1zrc B:138-207 [125533]
   Other proteins in same PDB: d1zrca2, d1zrcb2
   automated match to d1i5zb1
   protein/DNA complex; complexed with cmp

Details for d1zrcb1

PDB Entry: 1zrc, 2.8 Å

PDB Description: 4 crystal structures of cap-dna with all base-pair substitutions at position 6, cap-icap38 dna

PDB Compounds: (B:) Catabolite gene activator

SCOPe Domain Sequences for d1zrcb1:

Sequence; same for both SEQRES and ATOM records:

>d1zrcb1 a.4.5.4 (B:138-207) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvyg

Timeline for d1zrcb1:

• d1zrcb1 first appeared in SCOP 1.73
  
• d1zrcb1 appears in SCOPe 2.07