![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
![]() | Protein automated matches [190087] (15 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [186809] (11 PDB entries) |
![]() | Domain d1znya_: 1zny A: [125414] automated match to d1s4qa_ complexed with gdp |
PDB Entry: 1zny (more details), 2.3 Å
SCOPe Domain Sequences for d1znya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1znya_ c.37.1.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} vgrvvvlsgpsavgkstvvrclreripnlhfsvsattraprpgevdgvdyhfidptrfqq lidqgellewaeihgglhrsgtlaqpvraaaatgvpvlievdlagaraikktmpeavtvf lappswqdlqarligrgtetadviqrrldtarielaaqgdfdkvvvnrrlesacaelvsl lvg
Timeline for d1znya_: