SCOP 1.73: Domain d1znya1: 1zny A:20-201

Lineage for d1znya1 (1zny A:20-201)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (20 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Guanylate kinase [52542] (4 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [102339] (5 PDB entries)
   Rv1389

8. Domain d1znya1: 1zny A:20-201 [125414]
   automatically matched to d1s4qa_
   complexed with gdp

Details for d1znya1

PDB Entry: 1zny, 2.3 Å

PDB Description: Crystal Structure Of Mycobacterium tuberculosis Guanylate Kinase In Complex With GDP

PDB Compounds: (A:) Guanylate kinase

SCOP Domain Sequences for d1znya1:

Sequence; same for both SEQRES and ATOM records:

>d1znya1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}
vgrvvvlsgpsavgkstvvrclreripnlhfsvsattraprpgevdgvdyhfidptrfqq
lidqgellewaeihgglhrsgtlaqpvraaaatgvpvlievdlagaraikktmpeavtvf
lappswqdlqarligrgtetadviqrrldtarielaaqgdfdkvvvnrrlesacaelvsl
lv

Timeline for d1znya1:

• d1znya1 is new in SCOP 1.73
  
• d1znya1 appears in SCOP 1.75
  
• d1znya1 appears in the current release, SCOPe 2.08, called d1znya_