Lineage for d1zm6a1 (1zm6 A:1-120)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011697Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2011698Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2011703Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 protein domains)
    automatically mapped to Pfam PF00068
  6. 2011813Protein Snake phospholipase A2 [48624] (37 species)
  7. 2011829Species Andaman cobra (Naja sagittifera), isoform 4 [TaxId:195058] [89171] (14 PDB entries)
    Uniprot P60045 8-126 # ! yet another isoform, 98% identity
  8. 2011842Domain d1zm6a1: 1zm6 A:1-120 [125335]
    automatically matched to d1t37a_
    complexed with act

Details for d1zm6a1

PDB Entry: 1zm6 (more details), 2.6 Å

PDB Description: Crystal structure of the complex formed beween a group I phospholipase A2 and designed penta peptide Leu-Ala-Ile-Tyr-Ser at 2.6A resolution
PDB Compounds: (A:) Phospholipase A2 isoform 3

SCOPe Domain Sequences for d1zm6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zm6a1 a.133.1.2 (A:1-120) Snake phospholipase A2 {Andaman cobra (Naja sagittifera), isoform 4 [TaxId: 195058]}
nlyqfknmiqctvpsrswadfadygcycgkggsgtpvddldrccqthdncyneaenisgc
rpyfktysyectqgtltckgdnnacaasvcdcdrlaaicfagapynddnynidlkarcn

SCOPe Domain Coordinates for d1zm6a1:

Click to download the PDB-style file with coordinates for d1zm6a1.
(The format of our PDB-style files is described here.)

Timeline for d1zm6a1: