Class a: All alpha proteins [46456] (290 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
Protein Snake phospholipase A2 [48624] (38 species) |
Species Andaman cobra (Naja sagittifera), isoform 4 [TaxId:195058] [89171] (14 PDB entries) Uniprot P60045 8-126 # ! yet another isoform, 98% identity |
Domain d1t37a_: 1t37 A: [99116] complexed with act |
PDB Entry: 1t37 (more details), 2.6 Å
SCOPe Domain Sequences for d1t37a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t37a_ a.133.1.2 (A:) Snake phospholipase A2 {Andaman cobra (Naja sagittifera), isoform 4 [TaxId: 195058]} nlyqfknmiqctvpsrswadfadygcycgkggsgtpvddldrccqthdncyneaenisgc rpyfktysyectqgtltckgdnnacaasvcdcdrlaaicfagapynddnynidlkarcn
Timeline for d1t37a_: