PDB entry 1t37

View 1t37 on RCSB PDB site
Description: Design of specific inhibitors of phospholipase A2: Crystal structure of the complex formed between group I phospholipase A2 and a designed pentapeptide Leu-Ala-Ile-Tyr-Ser at 2.6A resolution
Class: hydrolase
Keywords: Phospholipase A2, complex, Inhibition, HYDROLASE
Deposited on 2004-04-25, released 2004-05-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.191
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase A2 isoform 3
    Species: Naja sagittifera [TaxId:195058]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60045 (0-117)
      • engineered (18)
      • engineered (45)
      • engineered (106)
    Domains in SCOPe 2.08: d1t37a_
  • Chain 'P':
    Compound: synthetic peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 1T37 (0-4)
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t37A (A:)
    nlyqfknmiqctvpsrswadfadygcycgkggsgtpvddldrccqthdncyneaenisgc
    rpyfktysyectqgtltckgdnnacaasvcdcdrlaaicfagapynddnynidlkarcn
    

  • Chain 'P':
    No sequence available.