PDB entry 1zm6

View 1zm6 on RCSB PDB site
Description: Crystal structure of the complex formed beween a group I phospholipase A2 and designed penta peptide Leu-Ala-Ile-Tyr-Ser at 2.6A resolution
Class: hydrolase
Keywords: peptide design, inhibitor, HYDROLASE
Deposited on 2005-05-10, released 2005-06-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.183
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase A2 isoform 3
    Species: Naja sagittifera [TaxId:195058]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60045 (0-117)
      • conflict (18)
      • conflict (45)
      • conflict (106)
    Domains in SCOPe 2.08: d1zm6a1
  • Chain 'P':
    Compound: designed penta peptide Leu-Ala-Ile-Tyr-Ser
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZM6 (0-4)
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1zm6A (A:)
nlyqfknmiqctvpsrswadfadygcycgkggsgtpvddldrccqthdncyneaenisgc
rpyfktysyectqgtltckgdnnacaasvcdcdrlaaicfagapynddnynidlkarcn

  • Chain 'P':
    No sequence available.