SCOPe 2.08: Domain d1zh5a1: 1zh5 A:5-103

Lineage for d1zh5a1 (1zh5 A:5-103)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.46: La domain [101051] (2 proteins)
   Pfam PF05383; RNA-binding domain

6. Protein Lupus La autoantigen N-terminal domain [101052] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101053] (7 PDB entries)

8. Domain d1zh5a1: 1zh5 A:5-103 [125073]
   Other proteins in same PDB: d1zh5a2, d1zh5b2
   automated match to d1zh5b1
   protein/RNA complex; complexed with so4

Details for d1zh5a1

PDB Entry: 1zh5, 1.85 Å

PDB Description: Structural basis for recognition of UUUOH 3'-terminii of nascent RNA pol III transcripts by La autoantigen

PDB Compounds: (A:) Lupus La protein

SCOPe Domain Sequences for d1zh5a1:

Sequence; same for both SEQRES and ATOM records:

>d1zh5a1 a.4.5.46 (A:5-103) Lupus La autoantigen N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gdnekmaaleakichqieyyfgdfnlprdkflkeqikldegwvpleimikfnrlnrlttd
fnvivealskskaelmeisedktkirrspskplpevtde

Timeline for d1zh5a1:

• d1zh5a1 first appeared in SCOP 1.73
  
• d1zh5a1 appears in SCOPe 2.07